PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018936
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 288aa    MW: 32409.7 Da    PI: 9.4603
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018936genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-173883147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+++G  +W++Ia+++  gR++k+c++rw++ 
      Lus10018936 38 RGHWRPAEDEKLRQLVEKYGAQNWNSIAEKLH-GRSGKSCRLRWFNQ 83
                     899*****************************.***********996 PP

2Myb_DNA-binding55.51.4e-1790133146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l+ a++ +G++ W+ I+r ++ gRt++ +k++w+ 
      Lus10018936  90 RRPFTEEEEERLLVAHRIHGNK-WAFISRLFP-GRTDNAVKNHWHV 133
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.5733384IPR017930Myb domain
SuperFamilySSF466895.62E-3036131IPR009057Homeodomain-like
SMARTSM007172.0E-143786IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-273991IPR009057Homeodomain-like
PfamPF139211.5E-1741101No hitNo description
CDDcd001672.13E-134182No hitNo description
PROSITE profilePS5129426.21485139IPR017930Myb domain
SMARTSM007179.8E-1589137IPR001005SANT/Myb domain
CDDcd001674.49E-1192132No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2092138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGDHEGKGGG VTSYNSCNSS SSSSTHHNNN SSSSSCPRGH WRPAEDEKLR QLVEKYGAQN  60
WNSIAEKLHG RSGKSCRLRW FNQLDPRINR RPFTEEEEER LLVAHRIHGN KWAFISRLFP  120
GRTDNAVKNH WHVIMARKQR EHSKHSDNKF VPSSRFCPTS KTNTSTCSPQ PSYLKEAING  180
NHIRACIYNN KSGCGPSIDH ATCRGSNLWN WVGCRVIVPS RYGYGSKVGG HGNHDYNNVM  240
NDHNHGIVKD QRVNARNEEE EEEDKRRRSE GVAPSFIDFL GVGVSSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31381387107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8307801e-121EU830780.1 Linum usitatissimum clone LU0030G02 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006434346.14e-76hypothetical protein CICLE_v10001803mg
RefseqXP_006473036.14e-76PREDICTED: myb-related protein 308-like
TrEMBLA0A067H7L14e-76A0A067H7L1_CITSI; Uncharacterized protein
TrEMBLV4TD414e-76V4TD41_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-62myb domain protein 52